PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010519722.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 631aa    MW: 71070.9 Da    PI: 10.397
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010519722.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.43.2e-081143235
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgR 35
                     g WT  E++llv avk++G+++W++Ia++++  R
   XP_010519722.1 11 GQWTILEELLLVFAVKRHGSKNWDAIANELQ-SR 43
                     78***************************99.66 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.655569IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-6645IPR009057Homeodomain-like
SuperFamilySSF466892.73E-6847IPR009057Homeodomain-like
PfamPF002493.7E-71143IPR001005SANT/Myb domain
CDDcd001672.47E-41347No hitNo description
SMARTSM002977.6E-15316428IPR001487Bromodomain
Gene3DG3DSA:1.20.920.101.7E-16328478IPR001487Bromodomain
CDDcd043694.09E-16328423No hitNo description
SuperFamilySSF473701.57E-17328425IPR001487Bromodomain
PROSITE profilePS5001412.623338409IPR001487Bromodomain
PfamPF004395.7E-10342412IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MAKKREPKPH GQWTILEELL LVFAVKRHGS KNWDAIANEL QSRGAIQRNY VSCSVITPET  60
CRDEFLRLRY RFSGEMTAEA DEEEVCPAPM LEELRQIRIE ELRREVKQHD VSIALLESKI  120
KRLEEESERR LTEKTDLRGG ESERGELKPS PASLSGKLSA SDKSNVRSPG DSIPTDQKPE  180
VATASSDAKN DAVKERKPAS TREPEGVTGT IPVILLTEPE RDQGSSSRFT RNADNGEDRT  240
DGGEVVTTSA TREGRHGESN ELRDSISESK REAAASKQSS DVQSSVTLSR RKRRRAGGCG  300
ASSDEEVVEI EEVSPAVRKK IAAVKPPESM VDLLRRIRSA RFGSAFDRRL RIQESERYRK  360
LIRQHMDLRT VKSRLEGGEY SEDSRTFYRD LLLLFNNAMV FYPRTSSRYT AAVELRALVV  420
KEMKLRLRNR IPESVTKRKP SKIVITASGK RTVSSRMKGK ENEQKKADNK DVKKERSSSN  480
NNKKGSNISE RTKMRVFGNN ELSSHDAHAI NTVNAKEVKK KKGAESFLRR MKKDLSTENE  540
EEEEDDERDV SGSEVEEEVK GMKKEKGVMM RNTSSSSSLG KRVREENMKG KKKTGKAVRE  600
IAKETAGKRG KESNGEASSD GGKRGKKRAR R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290294RKRRR
2622630KRGKKRARR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010519722.10.0PREDICTED: uncharacterized protein LOC104799085 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1708978
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57980.13e-30DNA-binding bromodomain-containing protein